PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00556.1_g00033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 286aa    MW: 32501.9 Da    PI: 6.3925
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00556.1_g00033.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.35.1e-16197252257
                              XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                              ++ +r++r++kNRe+A rsR+RK+a++ eLe+ +++Le eN++L ke+ee + e +
  Rsa1.0_00556.1_g00033.1 197 AAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLERENEQLLKEIEEKTRERY 252
                              5789********************************************98776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000416.7E-5729IPR001630cAMP response element binding (CREB) protein
PRINTSPR000416.7E-5195211IPR001630cAMP response element binding (CREB) protein
Gene3DG3DSA:1.20.5.1706.8E-13195251No hitNo description
SMARTSM003381.0E-12196261IPR004827Basic-leucine zipper domain
PfamPF001701.2E-14197252IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.208198250IPR004827Basic-leucine zipper domain
CDDcd147071.15E-16200246No hitNo description
SuperFamilySSF579595.69E-10200252No hitNo description
PROSITE patternPS000360203218IPR004827Basic-leucine zipper domain
PRINTSPR000416.7E-5213233IPR001630cAMP response element binding (CREB) protein
PRINTSPR000416.7E-5233250IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MASFKMMSSS TSRNSDLSRR NSSSASSSSP SVRSNHLRRD PHAADHSRIS FCYGGGGGND  60
ATTTVHDYAF AASDSMMDVD RRSNGDRNSV NGGGGGRKSV DDVWREIVSG EKKTVMKEEA  120
QDEYMMTLED FLAKAAEMDD NDDEIDVKIP PERLDYGDLS GTFDYLMMPQ QQQQHDQVEG  180
STRRKRGRVM VEAMDKAAAQ RQKRMIKNRE SAARSRERKQ AYQVELETLA AKLERENEQL  240
LKEIEEKTRE RYRSLMEQLI PVDDEKRRPS SSSLRSSLSR SYSLEW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013666408.11e-144PREDICTED: G-box-binding factor 4-like
RefseqXP_009119346.11e-144PREDICTED: G-box-binding factor 4
SwissprotP427771e-105GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A078DLS81e-144A0A078DLS8_BRANA; BnaA10g02300D protein
STRINGBra015281.1-P1e-143(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.13e-78G-box binding factor 4